PPM1J antibody (70R-4220)

Rabbit polyclonal PPM1J antibody

Synonyms Polyclonal PPM1J antibody, Anti-PPM1J antibody, Protein Phosphatase 1J antibody, MGC90149 antibody, PPM 1, MGC19531 antibody, FLJ35951 antibody, PP2CZ antibody, PPP2CZ antibody, Pp2C Domain Containing antibody, PP2Czeta antibody, PPM 1 antibody, PPM-1 antibody, PPM-1, PPM1, DKFZp434P1514 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PPM1J antibody was raised using a synthetic peptide corresponding to a region with amino acids YTALAQALVLGARGTPRDRGWRLPNNKLGSGDDISVFVIPLGGPGSYS
Assay Information PPM1J Blocking Peptide, catalog no. 33R-10255, is also available for use as a blocking control in assays to test for specificity of this PPM1J antibody

Images

Western Blot analysis using PPM1J antibody (70R-4220)

PPM1J antibody (70R-4220) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPM1J antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PPM1J is the serine/threonine protein phosphatase. The mouse homolog of this protein apparently belongs to the protein phosphatase 2C family. The exact function of this protein is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PPM1J antibody (70R-4220) | PPM1J antibody (70R-4220) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors