PPP1R8 antibody (70R-1468)

Rabbit polyclonal PPP1R8 antibody

Synonyms Polyclonal PPP1R8 antibody, Anti-PPP1R8 antibody, PPPR8 1, PPPR8-1, PPP1R8, PPPR8 1 antibody, Protein Phosphatase 1 Regulatory Inhibitor Subunit 8 antibody, PPPR8-1 antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen PPP1R8 antibody was raised using a synthetic peptide corresponding to a region with amino acids THGTFLGHIRLEPHKPQQIPIDSTVSFGASTRAYTLREKPQTLPSAVKGD
Assay Information PPP1R8 Blocking Peptide, catalog no. 33R-9105, is also available for use as a blocking control in assays to test for specificity of this PPP1R8 antibody


Western Blot analysis using PPP1R8 antibody (70R-1468)

PPP1R8 antibody (70R-1468) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PPP1R8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PPP1R8 antibody (70R-1468) | PPP1R8 antibody (70R-1468) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors