PPP2R3B antibody (70R-5596)

Rabbit polyclonal PPP2R3B antibody

Synonyms Polyclonal PPP2R3B antibody, Anti-PPP2R3B antibody, PPP2R, NY-REN-8 antibody, PR48 antibody, Protein Phosphatase 2 regulatory subunit B beta isoform antibody, PPPR-2 antibody, PPPR 2, PPPR 2 antibody, PPPR-2, PPP2R3L antibody, PPP2R3LY antibody
Cross Reactivity Human
Applications WB
Immunogen PPP2R3B antibody was raised using a synthetic peptide corresponding to a region with amino acids ELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQ
Assay Information PPP2R3B Blocking Peptide, catalog no. 33R-2572, is also available for use as a blocking control in assays to test for specificity of this PPP2R3B antibody


Western Blot analysis using PPP2R3B antibody (70R-5596)

PPP2R3B antibody (70R-5596) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPP2R3B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. PPP2R3B belongs to the B'' family. The B'' family has been further divided into subfamilies. PPP2R3B belongs to the beta subfamily of regulatory subunit B''.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PPP2R3B antibody (70R-5596) | PPP2R3B antibody (70R-5596) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors