PPP3CA antibody (70R-4113)

Rabbit polyclonal PPP3CA antibody

Synonyms Polyclonal PPP3CA antibody, Anti-PPP3CA antibody, CALN antibody, CALNA1 antibody, PPP 3, CALNA antibody, PPP-3, CNA1 antibody, PPP 3 antibody, PPP2B antibody, PPP-3 antibody, CCN1 antibody, Protein Phosphatase 3 catalytic subunit alpha isoform antibody, PPP3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PPP3CA antibody was raised using a synthetic peptide corresponding to a region with amino acids LPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINE
Assay Information PPP3CA Blocking Peptide, catalog no. 33R-5289, is also available for use as a blocking control in assays to test for specificity of this PPP3CA antibody

Images

Western Blot analysis using PPP3CA antibody (70R-4113)

PPP3CA antibody (70R-4113) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPP3CA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PPP3CA belongs to the PPP phosphatase family, PP-2B subfamily. It is a calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin. PPP3CA dephosphorylates HSPB1 and SSH1.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PPP3CA antibody (70R-4113) | PPP3CA antibody (70R-4113) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors