PPP6R1 antibody (70R-4067)

Rabbit polyclonal PPP6R1 antibody raised against the N terminal of PPP6R1

Synonyms Polyclonal PPP6R1 antibody, Anti-PPP6R1 antibody, PP6R1 antibody, MGC142003 antibody, KIAA1115 antibody, MGC138185 antibody, PPP 6, PPP-6 antibody, PPP6, PPP 6 antibody, SAP190 antibody, Protein Phosphatase 6 Regulatory Subunit 1 antibody, PPP-6
Specificity PPP6R1 antibody was raised against the N terminal of PPP6R1
Cross Reactivity Human
Applications WB
Immunogen PPP6R1 antibody was raised using the N terminal of PPP6R1 corresponding to a region with amino acids MFWKFDLHTSSHLDTLLEREDLSLPELLDEEDVLQECKVVNRKLLDFLLQ
Assay Information PPP6R1 Blocking Peptide, catalog no. 33R-6008, is also available for use as a blocking control in assays to test for specificity of this PPP6R1 antibody

Images

Western Blot analysis using PPP6R1 antibody (70R-4067)

PPP6R1 antibody (70R-4067) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 97 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPP6R1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Protein phosphatase regulatory subunits, such as SAPS1, modulate the activity of protein phosphatase catalytic subunits by restricting substrate specificity, recruiting substrates, and determining the intracellular localization of the holoenzyme. SAPS1 is a regulatory subunit for the protein phosphatase-6 catalytic subunit.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PPP6R1 antibody (70R-4067) | PPP6R1 antibody (70R-4067) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors