PRAME antibody (70R-2631)

Rabbit polyclonal PRAME antibody raised against the N terminal of PRAME

Synonyms Polyclonal PRAME antibody, Anti-PRAME antibody, Preferentially Expressed Antigen In Melanoma antibody, MAPE antibody, OIP4 antibody
Specificity PRAME antibody was raised against the N terminal of PRAME
Cross Reactivity Human
Applications WB
Immunogen PRAME antibody was raised using the N terminal of PRAME corresponding to a region with amino acids AMVQAWPFTCLPLGVLMKGQHLHLETFKAVLDGLDVLLAQEVRPRRWKLQ
Assay Information PRAME Blocking Peptide, catalog no. 33R-1390, is also available for use as a blocking control in assays to test for specificity of this PRAME antibody

Images

Western Blot analysis using PRAME antibody (70R-2631)

PRAME antibody (70R-2631) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRAME antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PRAME functions as a transcriptional repressor, inhibiting the signaling of retinoic acid through the retinoic acid receptors RARA, RARB and RARG. PRAME prevents retinoic acid-induced cell proliferation arrest, differentiation and apoptosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PRAME antibody (70R-2631) | PRAME antibody (70R-2631) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors