PRAMEF10 antibody (70R-3366)

Rabbit polyclonal PRAMEF10 antibody raised against the middle region of PRAMEF10

Synonyms Polyclonal PRAMEF10 antibody, Anti-PRAMEF10 antibody, RP5-845O24.7 antibody, Prame Family Member 10 antibody, MGC138415 antibody, MGC138413 antibody
Specificity PRAMEF10 antibody was raised against the middle region of PRAMEF10
Cross Reactivity Human
Applications WB
Immunogen PRAMEF10 antibody was raised using the middle region of PRAMEF10 corresponding to a region with amino acids DLLRHTGGLSKLGLELYPAPLESLDYKGHVNWEILTPIRAELMRTLREVR
Assay Information PRAMEF10 Blocking Peptide, catalog no. 33R-2057, is also available for use as a blocking control in assays to test for specificity of this PRAMEF10 antibody


Western Blot analysis using PRAMEF10 antibody (70R-3366)

PRAMEF10 antibody (70R-3366) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRAMEF10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PRAMEF10 belongs to the PRAME family. It contains 3 LRR (leucine-rich) repeats. The function of the PRAMEF10 protein remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PRAMEF10 antibody (70R-3366) | PRAMEF10 antibody (70R-3366) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors