PRDX2 antibody (70R-2270)

Rabbit polyclonal PRDX2 antibody raised against the middle region of PRDX2

Synonyms Polyclonal PRDX2 antibody, Anti-PRDX2 antibody, PRXII antibody, PRP antibody, TDPX1 antibody, MGC4104 antibody, TSA antibody, PRDX 2 antibody, Peroxiredoxin 2 antibody, PRDX 2, PRDX2, PRDX-2 antibody, PRX2 antibody, NKEFB antibody, PRDX-2
Specificity PRDX2 antibody was raised against the middle region of PRDX2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PRDX2 antibody was raised using the middle region of PRDX2 corresponding to a region with amino acids VLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTD
Assay Information PRDX2 Blocking Peptide, catalog no. 33R-9664, is also available for use as a blocking control in assays to test for specificity of this PRDX2 antibody


Western blot analysis using PRDX2 antibody (70R-2270)

Recommended PRDX2 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRDX2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PRDX2 is a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. It may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. The crystal structure of this protein has been resolved to 2.7 angstroms.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using PRDX2 antibody (70R-2270) | Recommended PRDX2 Antibody Titration: 0.2-1 ug/ml
  • Immunofluorescent staining using PRDX2 antibody (70R-2270) | Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue; Observed Staining: Cytoplasmic in cell bodies and processes of pinealocytes stained with PRDX antibody at 1:100
  • Immunohistochemical staining using PRDX2 antibody (70R-2270) | Liver

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors