PRIM2 antibody (70R-1012)

Rabbit polyclonal PRIM2 antibody

Synonyms Polyclonal PRIM2 antibody, Anti-PRIM2 antibody, PRIM2, PRIM-2 antibody, PRIM 2 antibody, PRIM-2, p58 antibody, Primase Dna Polypeptide 2 antibody, PRIM2A antibody, MGC75142 antibody, PRIM 2, RP3-401D24.1 antibody
Cross Reactivity Human
Applications WB
Immunogen PRIM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QDFLKDSQLQFEAISDEEKTLREQEIVASSPSLSGLKLGFKSIYKPPFAS
Assay Information PRIM2 Blocking Peptide, catalog no. 33R-7496, is also available for use as a blocking control in assays to test for specificity of this PRIM2 antibody

Images

Western Blot analysis using PRIM2 antibody (70R-1012)

PRIM2 antibody (70R-1012) used at 5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PRIM2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The replication of DNA in eukaryotic cells is carried out by a complex chromosomal replication apparatus, in which DNA polymerase alpha and primase are two key enzymatic components. Primase, which is a heterodimer of a small subunit and a large subunit, synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PRIM2 antibody (70R-1012) | PRIM2 antibody (70R-1012) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors