PRKCZ antibody (70R-2654)

Rabbit polyclonal PRKCZ antibody raised against the N terminal of PRKCZ

Synonyms Polyclonal PRKCZ antibody, Anti-PRKCZ antibody, Protein Kinase C Zeta antibody, PKC2 antibody
Specificity PRKCZ antibody was raised against the N terminal of PRKCZ
Cross Reactivity Human
Applications WB
Immunogen PRKCZ antibody was raised using the N terminal of PRKCZ corresponding to a region with amino acids MDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKP
Assay Information PRKCZ Blocking Peptide, catalog no. 33R-5876, is also available for use as a blocking control in assays to test for specificity of this PRKCZ antibody

Images

Western Blot analysis using PRKCZ antibody (70R-2654)

PRKCZ antibody (70R-2654) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRKCZ antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Protein kinase C (PKC) zeta is a member of the PKC family of serine/threonine kinases which are involved in a variety of cellular processes such as proliferation, differentiation and secretion. Unlike the classical PKC isoenzymes which are calcium-dependent, PKC zeta exhibits a kinase activity which is independent of calcium and diacylglycerol but not of phosphatidylserine.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PRKCZ antibody (70R-2654) | PRKCZ antibody (70R-2654) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors