PRKX antibody (70R-2237)

Rabbit polyclonal PRKX antibody raised against the N terminal of PRKX

Synonyms Polyclonal PRKX antibody, Anti-PRKX antibody, Protein Kinase X-Linked antibody, PKX1 antibody
Specificity PRKX antibody was raised against the N terminal of PRKX
Cross Reactivity Human
Applications WB
Immunogen PRKX antibody was raised using the N terminal of PRKX corresponding to a region with amino acids MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFD
Assay Information PRKX Blocking Peptide, catalog no. 33R-5894, is also available for use as a blocking control in assays to test for specificity of this PRKX antibody


Western Blot analysis using PRKX antibody (70R-2237)

PRKX antibody (70R-2237) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRKX antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a serine threonine protein kinase that has similarity to the catalytic subunit of cyclic AMP dependent protein kinases. The encoded protein is developmentally regulated and may be involved in renal epithelial morphogenesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PRKX antibody (70R-2237) | PRKX antibody (70R-2237) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors