PRMT1 antibody was raised against the middle region of PRMT1
Cross Reactivity
Human,Mouse,Rat,Dog,ZebraFish
Applications
IHC, WB
Immunogen
PRMT1 antibody was raised using the middle region of PRMT1 corresponding to a region with amino acids ESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVY
Assay Information
PRMT1 Blocking Peptide, catalog no. 33R-2736, is also available for use as a blocking control in assays to test for specificity of this PRMT1 antibody
Immunohistochemical staining using PRMT1 antibody (70R-1243)
PRMT1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
PRMT1 antibody
Immunohistochemical staining using PRMT1 antibody (70R-1243)
PRMT1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
Western Blot analysis using PRMT1 antibody (70R-1243)
PRMT1 antibody (70R-1243) used at 5 ug/ml to detect target protein.
Specifications
Host
Rabbit
Method of Purification
Total IgG Protein A purified
Molecular Weight
40 kDa (MW of target protein)
Form & Buffer
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PRMT1 antibody in PBS