PRMT1 antibody (70R-1243)

Rabbit polyclonal PRMT1 antibody raised against the middle region of PRMT1

Synonyms Polyclonal PRMT1 antibody, Anti-PRMT1 antibody, PRMT1, PRMT-1, PRMT 1 antibody, PRMT 1, Protein Arginine Methyltransferase 1 antibody, PRMT-1 antibody
Specificity PRMT1 antibody was raised against the middle region of PRMT1
Cross Reactivity Human,Mouse,Rat,Dog,ZebraFish
Applications IHC, WB
Immunogen PRMT1 antibody was raised using the middle region of PRMT1 corresponding to a region with amino acids ESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVY
Assay Information PRMT1 Blocking Peptide, catalog no. 33R-2736, is also available for use as a blocking control in assays to test for specificity of this PRMT1 antibody


Immunohistochemical staining using PRMT1 antibody (70R-1243)

PRMT1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PRMT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PRMT1 is a protein arginine methyltransferase that functions as a histone methyltransferase specific for H4.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using PRMT1 antibody (70R-1243) | PRMT1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using PRMT1 antibody (70R-1243) | PRMT1 antibody (70R-1243) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors