PRMT1 antibody (70R-1243)
Rabbit polyclonal PRMT1 antibody raised against the middle region of PRMT1
Overview
Overview
| Synonyms | Polyclonal PRMT1 antibody, Anti-PRMT1 antibody, PRMT1, PRMT-1, PRMT 1 antibody, PRMT 1, Protein Arginine Methyltransferase 1 antibody, PRMT-1 antibody |
|---|---|
| Specificity | PRMT1 antibody was raised against the middle region of PRMT1 |
| Cross Reactivity | Human,Mouse,Rat,Dog,ZebraFish |
| Applications | IHC, WB |
| Immunogen | PRMT1 antibody was raised using the middle region of PRMT1 corresponding to a region with amino acids ESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVY |
| Assay Information | PRMT1 Blocking Peptide, catalog no. 33R-2736, is also available for use as a blocking control in assays to test for specificity of this PRMT1 antibody |
Images
Immunohistochemical staining using PRMT1 antibody (70R-1243)
PRMT1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
PRMT1 antibody
Immunohistochemical staining using PRMT1 antibody (70R-1243)
PRMT1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
Western Blot analysis using PRMT1 antibody (70R-1243)
PRMT1 antibody (70R-1243) used at 5 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Total IgG Protein A purified |
| Molecular Weight | 40 kDa (MW of target protein) |
| Form & Buffer | Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PRMT1 antibody in PBS |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 5 ug/ml; IHC: 4-8 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | PRMT1 is a protein arginine methyltransferase that functions as a histone methyltransferase specific for H4. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product
