PRMT6 antibody (70R-3707)

Rabbit polyclonal PRMT6 antibody raised against the middle region of PRMT6

Synonyms Polyclonal PRMT6 antibody, Anti-PRMT6 antibody, PRMT 6, PRMT-6 antibody, FLJ10559 antibody, PRMT-6, PRMT6, HRMT1L6 antibody, PRMT 6 antibody, Protein Arginine Methyltransferase 6 antibody
Specificity PRMT6 antibody was raised against the middle region of PRMT6
Cross Reactivity Human
Applications WB
Immunogen PRMT6 antibody was raised using the middle region of PRMT6 corresponding to a region with amino acids FRCSCYGSAPMHGFAIWFQVTFPGGESEKPLVLSTSPFHPATHWKQALLY
Assay Information PRMT6 Blocking Peptide, catalog no. 33R-3040, is also available for use as a blocking control in assays to test for specificity of this PRMT6 antibody


Western Blot analysis using PRMT6 antibody (70R-3707)

PRMT6 antibody (70R-3707) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRMT6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Protein arginine N-methyltransferases, such as PRMT6, catalyze the sequential transfer of a methyl group from S-adenosyl-L-methionine to the side chain nitrogens of arginine residues within proteins to form methylated arginine derivatives and S-adenosyl-L-homocysteine.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PRMT6 antibody (70R-3707) | PRMT6 antibody (70R-3707) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors