PRODH2 antibody (70R-2398)

Rabbit polyclonal PRODH2 antibody

Synonyms Polyclonal PRODH2 antibody, Anti-PRODH2 antibody, PRODH2, PRODH 2, HSPOX1 antibody, Oxidase 2 antibody, PRODH-2, Proline Dehydrogenase antibody, PRODH-2 antibody, PRODH 2 antibody
Cross Reactivity Human,Dog
Applications IHC, WB
Immunogen PRODH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGIPLDGTVCFGQLLGMCDHVSLALGQAGYVVYKSIPYGSLEEVIPYLIR
Assay Information PRODH2 Blocking Peptide, catalog no. 33R-4976, is also available for use as a blocking control in assays to test for specificity of this PRODH2 antibody

Images

Western Blot analysis using PRODH2 antibody (70R-2398)

PRODH2 antibody (70R-2398) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRODH2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PRODH2 is similar to proline dehydrogenase (oxidase) 1, a mitochondrial enzyme which catalyzes the first step in proline catabolism. The function of this protein has not been determined.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PRODH2 antibody (70R-2398) | PRODH2 antibody (70R-2398) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors