PRODH2 antibody (70R-2398)

Rabbit polyclonal PRODH2 antibody

Synonyms Polyclonal PRODH2 antibody, Anti-PRODH2 antibody, PRODH2, PRODH 2, HSPOX1 antibody, Oxidase 2 antibody, PRODH-2, Proline Dehydrogenase antibody, PRODH-2 antibody, PRODH 2 antibody
Cross Reactivity Human,Dog
Applications IHC, WB
Immunogen PRODH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGIPLDGTVCFGQLLGMCDHVSLALGQAGYVVYKSIPYGSLEEVIPYLIR
Assay Information PRODH2 Blocking Peptide, catalog no. 33R-4976, is also available for use as a blocking control in assays to test for specificity of this PRODH2 antibody

Images

Immunohistochemical staining using PRODH2 antibody (70R-2398)

PRODH2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRODH2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PRODH2 is similar to proline dehydrogenase (oxidase) 1, a mitochondrial enzyme which catalyzes the first step in proline catabolism. The function of this protein has not been determined.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using PRODH2 antibody (70R-2398) | PRODH2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X
  • Western Blot analysis using PRODH2 antibody (70R-2398) | PRODH2 antibody (70R-2398) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors