Profilin 1 antibody (70R-2642)

Rabbit polyclonal Profilin 1 antibody raised against the N terminal of PFN1

Synonyms Polyclonal Profilin 1 antibody, Anti-Profilin 1 antibody, PFN1 antibody
Specificity Profilin 1 antibody was raised against the N terminal of PFN1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Profilin 1 antibody was raised using the N terminal of PFN1 corresponding to a region with amino acids AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVL
Assay Information Profilin 1 Blocking Peptide, catalog no. 33R-1234, is also available for use as a blocking control in assays to test for specificity of this Profilin 1 antibody

Images

Western Blot analysis using Profilin 1 antibody (70R-2642)

Profilin 1 antibody (70R-2642) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 15 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PFN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PFN1 is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Profilin 1 antibody (70R-2642) | Profilin 1 antibody (70R-2642) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors