Prohibitin 2 antibody (70R-2431)

Rabbit polyclonal Prohibitin 2 antibody raised against the N terminal of PHB2

Synonyms Polyclonal Prohibitin 2 antibody, Anti-Prohibitin 2 antibody, PNAS-141 antibody, REA antibody, p22 antibody, MGC117268 antibody, BAP antibody, PHB2 antibody, BCAP37 antibody, Bap37 antibody
Specificity Prohibitin 2 antibody was raised against the N terminal of PHB2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Prohibitin 2 antibody was raised using the N terminal of PHB2 corresponding to a region with amino acids WFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQR
Assay Information Prohibitin 2 Blocking Peptide, catalog no. 33R-9946, is also available for use as a blocking control in assays to test for specificity of this Prohibitin 2 antibody


Western Blot analysis using Prohibitin 2 antibody (70R-2431)

Prohibitin 2 antibody (70R-2431) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PHB2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PHB2 acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases (By similarity). It functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. PHB2 competes with NCOA1 for modulation of ER transcriptional activity. It probably involved in regulating mitochondrial respiration activity and in aging.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Prohibitin 2 antibody (70R-2431) | Prohibitin 2 antibody (70R-2431) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors