PRPH antibody (70R-2613)

Rabbit polyclonal PRPH antibody raised against the middle region of PRPH

Synonyms Polyclonal PRPH antibody, Anti-PRPH antibody, PRPH1 antibody, Peripherin antibody, NEF4 antibody
Specificity PRPH antibody was raised against the middle region of PRPH
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PRPH antibody was raised using the middle region of PRPH corresponding to a region with amino acids YKSKYADLSDAANRNHEALRQAKQEMNESRRQIQSLTCEVDGLRGTNEAL
Assay Information PRPH Blocking Peptide, catalog no. 33R-10156, is also available for use as a blocking control in assays to test for specificity of this PRPH antibody

Images

Western Blot analysis using PRPH antibody (70R-2613)

PRPH antibody (70R-2613) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRPH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a cytoskeletal protein found in neurons of the peripheral nervous system. The encoded protein is a type III intermediate filament protein with homology to other cytoskeletal proteins such as desmin.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PRPH antibody (70R-2613) | PRPH antibody (70R-2613) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors