PRRC1 antibody (70R-3262)

Rabbit polyclonal PRRC1 antibody raised against the middle region of PRRC1

Synonyms Polyclonal PRRC1 antibody, Anti-PRRC1 antibody, FLJ32875 antibody, PRRC 1, Proline-Rich Coiled-Coil 1 antibody, PRRC-1, PRRC 1 antibody, PRRC-1 antibody, PRRC1
Specificity PRRC1 antibody was raised against the middle region of PRRC1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PRRC1 antibody was raised using the middle region of PRRC1 corresponding to a region with amino acids VGEAGQSNIAPQPVGYAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIA
Assay Information PRRC1 Blocking Peptide, catalog no. 33R-9551, is also available for use as a blocking control in assays to test for specificity of this PRRC1 antibody

Images

Western Blot analysis using PRRC1 antibody (70R-3262)

PRRC1 antibody (70R-3262) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRRC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of PRRC1 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PRRC1 antibody (70R-3262) | PRRC1 antibody (70R-3262) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors