PSCD4 antibody (70R-4408)

Rabbit polyclonal PSCD4 antibody raised against the N terminal of PSCD4

Synonyms Polyclonal PSCD4 antibody, Anti-PSCD4 antibody, PSCD 4 antibody, PSCD-4, PSCD-4 antibody, Pleckstrin Homology Sec7 And Coiled-Coil Domains 4 antibody, PSCD 4, CYT4 antibody, PSCD4, DJ63G5.1 antibody
Specificity PSCD4 antibody was raised against the N terminal of PSCD4
Cross Reactivity Human
Applications WB
Immunogen PSCD4 antibody was raised using the N terminal of PSCD4 corresponding to a region with amino acids NKTAIGTYLGERDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGE
Assay Information PSCD4 Blocking Peptide, catalog no. 33R-6747, is also available for use as a blocking control in assays to test for specificity of this PSCD4 antibody


Western Blot analysis using PSCD4 antibody (70R-4408)

PSCD4 antibody (70R-4408) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSCD4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PSCD4 promotes guanine-nucleotide exchange on ARF1 and ARF5. PSCD4 promotes the activation of ARF through replacement of GDP with GTP.Pleckstrin homology, Sec7 and coiled/coil domains 4 (PSCD4) is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PSCD4 antibody (70R-4408) | PSCD4 antibody (70R-4408) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors