PSD3 antibody (70R-1226)

Rabbit polyclonal PSD3 antibody raised against the middle region of PSD3

Synonyms Polyclonal PSD3 antibody, Anti-PSD3 antibody, PSD-3 antibody, EFA6R antibody, HCA67 antibody, Pleckstrin And Sec7 Domain Containing 3 antibody, DKFZp761K1423 antibody, PSD 3, PSD 3 antibody, PSD-3, PSD3
Specificity PSD3 antibody was raised against the middle region of PSD3
Cross Reactivity Human,Mouse,Rat
Applications IHC, WB
Immunogen PSD3 antibody was raised using the middle region of PSD3 corresponding to a region with amino acids SDVAKHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFFKAFSLVGETQ
Assay Information PSD3 Blocking Peptide, catalog no. 33R-8378, is also available for use as a blocking control in assays to test for specificity of this PSD3 antibody


Immunohistochemical staining using PSD3 antibody (70R-1226)

PSD3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PSD3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PSD3 is a guanine nucleotide exchange factor for ARF6.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using PSD3 antibody (70R-1226) | PSD3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X
  • Western Blot analysis using PSD3 antibody (70R-1226) | PSD3 antibody (70R-1226) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors