PSG9 antibody (70R-3923)

Rabbit polyclonal PSG9 antibody raised against the N terminal of PSG9

Synonyms Polyclonal PSG9 antibody, Anti-PSG9 antibody, PSG-9, PSG-9 antibody, PSG 9, PSGII antibody, Pregnancy Specific Beta-1-Glycoprotein 9 antibody, PSG9, PSG11 antibody, PSG 9 antibody
Specificity PSG9 antibody was raised against the N terminal of PSG9
Cross Reactivity Human
Applications WB
Immunogen PSG9 antibody was raised using the N terminal of PSG9 corresponding to a region with amino acids YSNASLLIQNVTRKDAGTYTLHIIKRGDETREEIRHFTFTLYLETPKPYI
Assay Information PSG9 Blocking Peptide, catalog no. 33R-10245, is also available for use as a blocking control in assays to test for specificity of this PSG9 antibody


Western Blot analysis using PSG9 antibody (70R-3923)

PSG9 antibody (70R-3923) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSG9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The human pregnancy-specific glycoproteins (PSGs) are a group of molecules that are mainly produced by the placental syncytiotrophoblasts during pregnancy. PSGs comprise a subgroup of the carcinoembryonic antigen (CEA) family, which belongs to the immunoglobulin superfamily.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PSG9 antibody (70R-3923) | PSG9 antibody (70R-3923) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors