PSMA4 antibody (70R-4317)

Rabbit polyclonal PSMA4 antibody

Synonyms Polyclonal PSMA4 antibody, Anti-PSMA4 antibody, PSMA4, PSMA-4, HsT17706 antibody, PSMA-4 antibody, Prosome Macropain Subunit Alpha Type 4 antibody, MGC111191 antibody, PSMA 4 antibody, HC9 antibody, PSMA 4, MGC24813 antibody, Proteasome macropain subunit alpha type 4 antibody, MGC12467 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PSMA4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGN
Assay Information PSMA4 Blocking Peptide, catalog no. 33R-6994, is also available for use as a blocking control in assays to test for specificity of this PSMA4 antibody


Western Blot analysis using PSMA4 antibody (70R-4317)

PSMA4 antibody (70R-4317) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSMA4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PSMA4 antibody (70R-4317) | PSMA4 antibody (70R-4317) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors