PSMA5 antibody (70R-4325)

Rabbit polyclonal PSMA5 antibody

Synonyms Polyclonal PSMA5 antibody, Anti-PSMA5 antibody, PSMA 5 antibody, MGC125803 antibody, PSMA5, MGC117302 antibody, MGC125802 antibody, Proteasome macropain subunit alpha type 5 antibody, PSMA-5, PSMA 5, MGC125804 antibody, ZETA antibody, PSMA-5 antibody, Prosome Macropain Subunit Alpha Type 5 antibody, PSC5 antibody
Cross Reactivity Human,Mouse,Rat,C.elegans,Drosophila
Applications WB
Immunogen PSMA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAV
Assay Information PSMA5 Blocking Peptide, catalog no. 33R-5998, is also available for use as a blocking control in assays to test for specificity of this PSMA5 antibody

Images

Western Blot analysis using PSMA5 antibody (70R-4325)

PSMA5 antibody (70R-4325) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSMA5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PSMA5 antibody (70R-4325) | PSMA5 antibody (70R-4325) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors