PSMD12 antibody (70R-4479)

Rabbit polyclonal PSMD12 antibody

Synonyms Polyclonal PSMD12 antibody, Anti-PSMD12 antibody, Proteasome macropain 26S subunit non-ATPase 12 antibody, PSMD-12, PSMD 12, Prosome Macropain 26S Subunit Non-Atpase 12 antibody, MGC75406 antibody, PSMD-12 antibody, p55 antibody, PSMD 12 antibody, PSMD12
Cross Reactivity Human
Applications WB
Immunogen PSMD12 antibody was raised using a synthetic peptide corresponding to a region with amino acids KYKDLLKLFTTMELMRWSTLVEDYGMELRKGSLESPATDVFGSTEEGEKR
Assay Information PSMD12 Blocking Peptide, catalog no. 33R-4742, is also available for use as a blocking control in assays to test for specificity of this PSMD12 antibody


Western Blot analysis using PSMD12 antibody (70R-4479)

PSMD12 antibody (70R-4479) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSMD12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. A pseudogene has been identified on chromosome 3.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PSMD12 antibody (70R-4479) | PSMD12 antibody (70R-4479) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors