PSMD3 antibody (70R-4327)

Rabbit polyclonal PSMD3 antibody

Synonyms Polyclonal PSMD3 antibody, Anti-PSMD3 antibody, PSMD-3 antibody, Prosome Macropain 26S Subunit Non-Atpase 3 antibody, PSMD 3 antibody, RPN3 antibody, PSMD3, Proteasome macropain 26S subunit non-ATPase 3 antibody, S3 antibody, PSMD 3, PSMD-3, P58 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PSMD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMDTEADLQFRPRTGKAAS
Assay Information PSMD3 Blocking Peptide, catalog no. 33R-8042, is also available for use as a blocking control in assays to test for specificity of this PSMD3 antibody


Western Blot analysis using PSMD3 antibody (70R-4327)

PSMD3 antibody (70R-4327) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSMD3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PSMD3 antibody (70R-4327) | PSMD3 antibody (70R-4327) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors