PSME3 antibody (70R-2344)

Rabbit polyclonal PSME3 antibody raised against the N terminal of PSME3

Synonyms Polyclonal PSME3 antibody, Anti-PSME3 antibody, Prosome Macropain Activator Subunit 3 antibody, PSME 3 antibody, PA28-gamma antibody, Proteasome macropain activator subunit 3, REG-GAMMA antibody, PSME 3, PA28G antibody, PSME-3 antibody, Ki antibody, PSME3, PSME-3
Specificity PSME3 antibody was raised against the N terminal of PSME3
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen PSME3 antibody was raised using the N terminal of PSME3 corresponding to a region with amino acids PILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQ
Assay Information PSME3 Blocking Peptide, catalog no. 33R-7157, is also available for use as a blocking control in assays to test for specificity of this PSME3 antibody


Immunohistochemical staining using PSME3 antibody (70R-2344)

PSME3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSME3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using PSME3 antibody (70R-2344) | PSME3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using PSME3 antibody (70R-2344) | PSME3 antibody (70R-2344) used at 0.25 ug/ml to detect target protein.
  • Immunohistochemical staining using PSME3 antibody (70R-2344) | PSME3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors