PSMG1 antibody (70R-3339)

Rabbit polyclonal PSMG1 antibody

Synonyms Polyclonal PSMG1 antibody, Anti-PSMG1 antibody, C21LRP antibody, PSMG1, PSMG 1, PSMG 1 antibody, LRPC21 antibody, DSCR2 antibody, Proteasome macropain assembly chaperone 1 antibody, PSMG-1, PSMG-1 antibody, PAC1 antibody, Prosome Macropain Assembly Chaperone 1 antibody
Cross Reactivity Human
Applications WB
Immunogen PSMG1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TILTCRHVTDYKTSESTGSLPSPFLRALKTQNFKDSACCPLLEQPNIVHD
Assay Information PSMG1 Blocking Peptide, catalog no. 33R-9122, is also available for use as a blocking control in assays to test for specificity of this PSMG1 antibody


Western Blot analysis using PSMG1 antibody (70R-3339)

PSMG1 antibody (70R-3339) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSMG1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PSMG1 is a chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG2. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PSMG1 antibody (70R-3339) | PSMG1 antibody (70R-3339) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors