PSPH antibody (70R-4330)

Rabbit polyclonal PSPH antibody raised against the middle region of PSPH

Synonyms Polyclonal PSPH antibody, Anti-PSPH antibody, Phosphoserine Phosphatase antibody, PSP antibody
Specificity PSPH antibody was raised against the middle region of PSPH
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PSPH antibody was raised using the middle region of PSPH corresponding to a region with amino acids IMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELE
Assay Information PSPH Blocking Peptide, catalog no. 33R-4067, is also available for use as a blocking control in assays to test for specificity of this PSPH antibody


Western Blot analysis using PSPH antibody (70R-4330)

PSPH antibody (70R-4330) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSPH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene belongs to a subfamily of the phosphotransferases. This encoded enzyme is responsible for the third and last step in L-serine formation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PSPH antibody (70R-4330) | PSPH antibody (70R-4330) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors