PSTK antibody (70R-4183)

Rabbit polyclonal PSTK antibody raised against the middle region of PSTK

Synonyms Polyclonal PSTK antibody, Anti-PSTK antibody, MGC35392 antibody, Phosphoseryl-tRNA Kinase antibody, C10orf89 antibody
Specificity PSTK antibody was raised against the middle region of PSTK
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PSTK antibody was raised using the middle region of PSTK corresponding to a region with amino acids SRPLFLVLDDNFYYQSMRYEVYQLARKYSLGFCQLFLDCPLETCLQRNGQ
Assay Information PSTK Blocking Peptide, catalog no. 33R-8766, is also available for use as a blocking control in assays to test for specificity of this PSTK antibody

Images

Western Blot analysis using PSTK antibody (70R-4183)

PSTK antibody (70R-4183) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PSTK antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PSTK specifically phosphorylates seryl-tRNA(Sec) to O-phosphoseryl-tRNA(Sec), an activated intermediate for selenocysteine biosynthesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PSTK antibody (70R-4183) | PSTK antibody (70R-4183) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors