PTBP1 antibody (70R-4626)

Rabbit polyclonal PTBP1 antibody raised against the N terminal of PTBP1

Synonyms Polyclonal PTBP1 antibody, Anti-PTBP1 antibody, PTBP 1 antibody, PTB2 antibody, Polypyrimidine Tract Binding Protein 1 antibody, PTB-T antibody, PTBP-1, PTB-1 antibody, MGC8461 antibody, PTBP1, HNRNPI antibody, PTBP-1 antibody, PTB antibody, MGC10830 antibody, HNRPI antibody, PTBP 1, PTB3 antibody, PTB4 antibody, pPTB antibody
Specificity PTBP1 antibody was raised against the N terminal of PTBP1
Cross Reactivity Human
Applications WB
Immunogen PTBP1 antibody was raised using the N terminal of PTBP1 corresponding to a region with amino acids RGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDSRSAGVPSRVIHI
Assay Information PTBP1 Blocking Peptide, catalog no. 33R-7938, is also available for use as a blocking control in assays to test for specificity of this PTBP1 antibody

Images

Western Blot analysis using PTBP1 antibody (70R-4626)

PTBP1 antibody (70R-4626) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PTBP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PTBP1 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA-binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PTBP1 antibody (70R-4626) | PTBP1 antibody (70R-4626) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors