PTBP1 antibody (70R-4627)

Rabbit polyclonal PTBP1 antibody raised against the middle region of PTBP1

Synonyms Polyclonal PTBP1 antibody, Anti-PTBP1 antibody, PTB-1 antibody, PTB-T antibody, PTB antibody, PTB2 antibody, pPTB antibody, PTB3 antibody, PTBP 1 antibody, PTBP1, HNRNP-I antibody, HNRNPI antibody, Polypyrimidine Tract Binding Protein 1 antibody, PTBP-1, MGC10830 antibody, MGC8461 antibody, HNRPI antibody, PTBP 1, PTBP-1 antibody, PTB4 antibody
Specificity PTBP1 antibody was raised against the middle region of PTBP1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PTBP1 antibody was raised using the middle region of PTBP1 corresponding to a region with amino acids KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI
Assay Information PTBP1 Blocking Peptide, catalog no. 33R-4388, is also available for use as a blocking control in assays to test for specificity of this PTBP1 antibody

Images

Western Blot analysis using PTBP1 antibody (70R-4627)

PTBP1 antibody (70R-4627) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PTBP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PTBP1 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA-binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PTBP1 antibody (70R-4627) | PTBP1 antibody (70R-4627) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors