PTGER3 antibody (70R-1196)

Rabbit polyclonal PTGER3 antibody

Synonyms Polyclonal PTGER3 antibody, Anti-PTGER3 antibody, PTGER-3 antibody, EP3-III antibody, EP3-II antibody, MGC141829 antibody, EP3e antibody, PTGER 3, EP3-IV antibody, PTGER 3 antibody, Prostaglandin E Receptor 3 antibody, PTGER3, MGC27302 antibody, MGC141828 antibody, EP3-I antibody, PTGER-3, EP3 antibody
Cross Reactivity Human
Applications WB
Immunogen PTGER3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDPWVYLLLRKILLRKFCQIRYHTNNYASSSTSLPCQCSSTLMWSDHLER
Assay Information PTGER3 Blocking Peptide, catalog no. 33R-4856, is also available for use as a blocking control in assays to test for specificity of this PTGER3 antibody

Western Blot analysis using PTGER3 antibody (70R-1196)

PTGER3 antibody (70R-1196) used at 2.4 ug/ml to detect target protein.

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PTGER3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.4 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PTGER3 is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2 (PGE2). This receptor may have many biological functions, which involve digestion, nervous system, kidney reabsorption, and uterine contraction activities. Studies of the mouse counterpart suggest that this receptor may also mediate adrenocorticotropic hormone response as well as fever generation in response to exogenous and endogenous stimuli.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using PTGER3 antibody (70R-1196) | PTGER3 antibody (70R-1196) used at 2.4 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors