PTHLH antibody (70R-1717)

Rabbit polyclonal PTHLH antibody raised against the middle region of PTHLH

Synonyms Polyclonal PTHLH antibody, Anti-PTHLH antibody, Parathyroid Hormone-Like Hormone antibody
Specificity PTHLH antibody was raised against the middle region of PTHLH
Cross Reactivity Human, Dog
Applications IHC, WB
Immunogen PTHLH antibody was raised using the middle region of PTHLH corresponding to a region with amino acids YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS
Assay Information PTHLH Blocking Peptide, catalog no. 33R-10147, is also available for use as a blocking control in assays to test for specificity of this PTHLH antibody


Western Blot analysis using PTHLH antibody (70R-1717)

PTHLH antibody (70R-1717) used at 2 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PTHLH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PTHLH is a member of the parathyroid hormone family. This hormone regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. This hormone is involved in lactation possibly by regulating the mobilization and transfer of calcium to the milk. The receptor of this hormone, PTHR1, is responsible for most cases of humoral hypercalcemia of malignancy. Four alternatively spliced transcript variants encoding two distinct isoforms have been observed.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PTHLH antibody (70R-1717) | PTHLH antibody (70R-1717) used at 2 ug/ml to detect target protein.
  • Immunohistochemical staining using PTHLH antibody (70R-1717) | PTHLH antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (lndicated with Arrows) in Human Lung. Magnification is at 400X

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors