PUF60 antibody (70R-4912)

Rabbit polyclonal PUF60 antibody raised against the C terminal of PUF60

Synonyms Polyclonal PUF60 antibody, Anti-PUF60 antibody, FLJ31379 antibody, PUF-60, RoBPI antibody, SIAHBP1 antibody, FIR antibody, PUF 60 antibody, PUF 60, PUF60, Poly-U Binding Splicing Factor 60Kda antibody, PUF-60 antibody
Specificity PUF60 antibody was raised against the C terminal of PUF60
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PUF60 antibody was raised using the C terminal of PUF60 corresponding to a region with amino acids EIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA
Assay Information PUF60 Blocking Peptide, catalog no. 33R-2474, is also available for use as a blocking control in assays to test for specificity of this PUF60 antibody


Western Blot analysis using PUF60 antibody (70R-4912)

PUF60 antibody (70R-4912) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PUF60 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PUF60 is a Ro RNP-binding protein. It interacts with Ro RNPs and their interaction is thought to represent a gain of function for Ro RNPs. This protein also forms a ternary complex with far upstream element (FUSE) and FUSE-binding protein. It can repress a c-myc reporter via the FUSE. It is also known to target transcription factor IIH and inhibit activated transcription.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PUF60 antibody (70R-4912) | PUF60 antibody (70R-4912) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors