PURB antibody (70R-4611)

Rabbit polyclonal PURB antibody raised against the N terminal of PURB

Synonyms Polyclonal PURB antibody, Anti-PURB antibody, MGC126786 antibody, MGC126784 antibody, Purine-Rich Element Binding Protein B antibody, PURBETA antibody
Specificity PURB antibody was raised against the N terminal of PURB
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PURB antibody was raised using the N terminal of PURB corresponding to a region with amino acids MADGDSGSERGGGGGPCGFQPASRGGGEQETQELASKRLDIQNKRFYLDV
Assay Information PURB Blocking Peptide, catalog no. 33R-5621, is also available for use as a blocking control in assays to test for specificity of this PURB antibody


Western Blot analysis using PURB antibody (70R-4611)

PURB antibody (70R-4611) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PURB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene product is a sequence-specific, single-stranded DNA-binding protein.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PURB antibody (70R-4611) | PURB antibody (70R-4611) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors