PUS10 antibody (70R-3290)

Rabbit polyclonal PUS10 antibody raised against the middle region of PUS10

Synonyms Polyclonal PUS10 antibody, Anti-PUS10 antibody, PUS10, MGC126729 antibody, PUS 10, PUS 10 antibody, FLJ32312 antibody, Pseudouridylate Synthase 10 antibody, PUS-10, MGC126755 antibody, PUS-10 antibody
Specificity PUS10 antibody was raised against the middle region of PUS10
Cross Reactivity Human
Applications WB
Immunogen PUS10 antibody was raised using the middle region of PUS10 corresponding to a region with amino acids AVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISDHLLAVFKAESFN
Assay Information PUS10 Blocking Peptide, catalog no. 33R-1592, is also available for use as a blocking control in assays to test for specificity of this PUS10 antibody


Western Blot analysis using PUS10 antibody (70R-3290)

PUS10 antibody (70R-3290) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PUS10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Pseudouridination, the isomerization of uridine to pseudouridine, is the most common posttranscriptional nucleotide modification found in RNA and is essential for biologic functions such as spliceosome biogenesis. Pseudouridylate synthases, such as PUS10, catalyze pseudouridination of structural RNAs, including transfer, ribosomal, and splicing RNAs. These enzymes also act as RNA chaperones, facilitating the correct folding and assembly of tRNAs.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PUS10 antibody (70R-3290) | PUS10 antibody (70R-3290) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors