PUS7 antibody (70R-1241)

Rabbit polyclonal PUS7 antibody

Synonyms Polyclonal PUS7 antibody, Anti-PUS7 antibody, PUS 7, FLJ20485 antibody, KIAA1897 antibody, PUS 7 antibody, PUS-7, PUS7, MGC17720 antibody, Pseudouridylate Synthase 7 Homolog antibody, PUS-7 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PUS7 antibody was raised using a synthetic peptide corresponding to a region with amino acids FADMMKHGLTEADVGITKFVSSHQGFSGILKERYSDFVVHEIGKDGRISH
Assay Information PUS7 Blocking Peptide, catalog no. 33R-2838, is also available for use as a blocking control in assays to test for specificity of this PUS7 antibody

Images

Western Blot analysis using PUS7 antibody (70R-1241)

PUS7 antibody (70R-1241) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 75 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PUS7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PUS7 is involved in RNA binding, pseudouridine synthase activity and isomerase activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PUS7 antibody (70R-1241) | PUS7 antibody (70R-1241) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors