PWP2 antibody (70R-1968)

Rabbit polyclonal PWP2 antibody

Synonyms Polyclonal PWP2 antibody, Anti-PWP2 antibody, PWP 2, PWP2H antibody, Pwp2 Periodic Tryptophan Protein Homolog antibody, PWP-2 antibody, PWP-2, PWP2, PWP 2 antibody, EHOC-17 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PWP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VQTGSIEGRHDLKTGRKELDKITAKHAAKGKAFTALCYSADGHSILAGGM
Assay Information PWP2 Blocking Peptide, catalog no. 33R-9762, is also available for use as a blocking control in assays to test for specificity of this PWP2 antibody


Western Blot analysis using PWP2 antibody (70R-1968)

PWP2 antibody (70R-1968) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 102 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PWP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PWP2 belongs to the WD repeat PWP2 family. It contains 14 WD repeats. The exact function of PWP2 is not known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PWP2 antibody (70R-1968) | PWP2 antibody (70R-1968) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors