QTRT1 antibody (70R-2164)

Rabbit polyclonal QTRT1 antibody

Synonyms Polyclonal QTRT1 antibody, Anti-QTRT1 antibody, FP3235 antibody, TGT antibody, tRNA-Rna Guanine Transglycosylase antibody, Queuine tRNA-Ribosyltransferase 1 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen QTRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQL
Assay Information QTRT1 Blocking Peptide, catalog no. 33R-4290, is also available for use as a blocking control in assays to test for specificity of this QTRT1 antibody


Western Blot analysis using QTRT1 antibody (70R-2164)

QTRT1 antibody (70R-2164) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of QTRT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance tRNA-guanine transglycosylase synthesizes queuosine (Q), which is found in tRNAs that recognise NAU and NAC codons, encoding tyr, asn, asp, and his. Prokaryotic TGT is a single protein of 43 kDa. In contrast, mammalian TGT appears to be a heterodimer consisting of a 60 kDa subunit and a 43 kDa catalytic subunit.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using QTRT1 antibody (70R-2164) | QTRT1 antibody (70R-2164) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors