QTRTD1 antibody (70R-2066)

Rabbit polyclonal QTRTD1 antibody raised against the N terminal of QTRTD1

Synonyms Polyclonal QTRTD1 antibody, Anti-QTRTD1 antibody, Queuine tRNA-Ribosyltransferase Domain Containing 1 antibody, FLJ12960 antibody
Specificity QTRTD1 antibody was raised against the N terminal of QTRTD1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen QTRTD1 antibody was raised using the N terminal of QTRTD1 corresponding to a region with amino acids YTKTGSAPHLTHHTLHNIHGVPAMAQLTLSSLAEHHEVLTEYKEGVGKFI
Assay Information QTRTD1 Blocking Peptide, catalog no. 33R-10263, is also available for use as a blocking control in assays to test for specificity of this QTRTD1 antibody


Western Blot analysis using QTRTD1 antibody (70R-2066)

QTRTD1 antibody (70R-2066) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of QTRTD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance QTRTD1 belongs to the queuine tRNA-ribosyltransferase family. The function of the QTRTD1 protein remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using QTRTD1 antibody (70R-2066) | QTRTD1 antibody (70R-2066) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors