RAB3IP antibody (70R-4196)

Rabbit polyclonal RAB3IP antibody

Synonyms Polyclonal RAB3IP antibody, Anti-RAB3IP antibody, RABA-3 antibody, FLJ22548 antibody, RABIN3 antibody, Rabin3 antibody, RABA 3, RAB3A, RABA 3 antibody, RABA-3, MGC71495 antibody, FLJ14660 antibody, Rab3A Interacting Protein antibody
Cross Reactivity Human
Applications WB
Immunogen RAB3IP antibody was raised using a synthetic peptide corresponding to a region with amino acids APCSTSGVTAGLTKLTTRKDNYNAEREFLQGATITEACDGSDDIFGLSTD
Assay Information RAB3IP Blocking Peptide, catalog no. 33R-1417, is also available for use as a blocking control in assays to test for specificity of this RAB3IP antibody


Western Blot analysis using RAB3IP antibody (70R-4196)

RAB3IP antibody (70R-4196) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAB3IP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of RAB3A protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RAB3IP antibody (70R-4196) | RAB3IP antibody (70R-4196) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors