RAB40C antibody (70R-3451)

Rabbit polyclonal RAB40C antibody raised against the N terminal of RAB40C

Synonyms Polyclonal RAB40C antibody, Anti-RAB40C antibody, RASL8C antibody, Rab40C Member Ras Oncogene Family antibody, RARL antibody, RABC 40, RABC-40 antibody, RABC 40 antibody, RABC-40, RAB40C
Specificity RAB40C antibody was raised against the N terminal of RAB40C
Cross Reactivity Human
Applications WB
Immunogen RAB40C antibody was raised using the N terminal of RAB40C corresponding to a region with amino acids QDGAAESPYAYSNGIDYKTTTILLDGRRVRLELWDTSGQGRFCTIFRSYS
Assay Information RAB40C Blocking Peptide, catalog no. 33R-7497, is also available for use as a blocking control in assays to test for specificity of this RAB40C antibody


Western Blot analysis using RAB40C antibody (70R-3451)

RAB40C antibody (70R-3451) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAB40C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAB40C is a probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RAB40C antibody (70R-3451) | RAB40C antibody (70R-3451) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors