RAD23B antibody (70R-3309)

Rabbit polyclonal RAD23B antibody

Synonyms Polyclonal RAD23B antibody, Anti-RAD23B antibody, HHR23B antibody, Rad23 Homolog B antibody, RADB-23, RADB-23 antibody, RADB 23, RAD23B, P58 antibody, HR23B antibody, RADB 23 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RAD23B antibody was raised using a synthetic peptide corresponding to a region with amino acids QMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAG
Assay Information RAD23B Blocking Peptide, catalog no. 33R-7658, is also available for use as a blocking control in assays to test for specificity of this RAD23B antibody

Images

Western Blot analysis using RAD23B antibody (70R-3309)

RAD23B antibody (70R-3309) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAD23B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in the nucleotide excision repair (NER).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RAD23B antibody (70R-3309) | RAD23B antibody (70R-3309) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors