RAD51AP1 antibody (70R-4860)

Rabbit polyclonal RAD51AP1 antibody raised against the middle region of RAD51AP1

Synonyms Polyclonal RAD51AP1 antibody, Anti-RAD51AP1 antibody, RAD 51, Rad51 Associated Protein 1 antibody, RAD 51 antibody, RAD51, RAD-51 antibody, PIR51 antibody, RAD-51
Specificity RAD51AP1 antibody was raised against the middle region of RAD51AP1
Cross Reactivity Human
Applications WB
Immunogen RAD51AP1 antibody was raised using the middle region of RAD51AP1 corresponding to a region with amino acids EDDVGGVQGKRKAASKAAAQQRKILLEGSDGDSANDTEPDFAPGEDSEDD
Assay Information RAD51AP1 Blocking Peptide, catalog no. 33R-2308, is also available for use as a blocking control in assays to test for specificity of this RAD51AP1 antibody


Western Blot analysis using RAD51AP1 antibody (70R-4860)

RAD51AP1 antibody (70R-4860) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Supplied as cell culture supernatant.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAD51AP1 may participate in a common DNA damage response pathway associated with the activation of homologous recombination and double-strand break repair. RAD51AP1 binds to single and double stranded DNA, and is capable of aggregating DNA. RAD51AP1 also binds RNA.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RAD51AP1 antibody (70R-4860) | RAD51AP1 antibody (70R-4860) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors