RAD54L antibody (70R-5645)

Rabbit polyclonal RAD54L antibody

Synonyms Polyclonal RAD54L antibody, Anti-RAD54L antibody, Rad54-Like antibody, RADL-54 antibody, RADL 54, RAD54L, HR54 antibody, RADL 54 antibody, RADL-54, hHR54 antibody, RAD54A antibody, hRAD54 antibody
Cross Reactivity Human
Applications WB
Immunogen RAD54L antibody was raised using a synthetic peptide corresponding to a region with amino acids VVSPSSLVKNWYNEVGKWLGGRIQPLAIDGGSKDEIDQKLEGFMNQRGAR
Assay Information RAD54L Blocking Peptide, catalog no. 33R-9897, is also available for use as a blocking control in assays to test for specificity of this RAD54L antibody

Images

Western Blot analysis using RAD54L antibody (70R-5645)

RAD54L antibody (70R-5645) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 84 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAD54L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This protein belongs to the DEAD-like helicase superfamily, and shares similarity with Saccharomyces cerevisiae Rad54, a protein known to be involved in the homologous recombination and repair of DNA. This protein has been shown to play a role in homologous recombination related repair of DNA double-strand breaks. The binding of this protein to double-strand DNA induces a DNA topological change, which is thought to facilitate homologous DNA paring, and stimulate DNA recombination.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RAD54L antibody (70R-5645) | RAD54L antibody (70R-5645) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors