RAE1 antibody (70R-4675)

Rabbit polyclonal RAE1 antibody

Synonyms Polyclonal RAE1 antibody, Anti-RAE1 antibody, RAE 1, RAE 1 antibody, RAE-1, Rae1 Rna Export 1 Homolog antibody, RAE-1 antibody, RAE1
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen RAE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEE
Assay Information RAE1 Blocking Peptide, catalog no. 33R-2670, is also available for use as a blocking control in assays to test for specificity of this RAE1 antibody


Immunohistochemical staining using RAE1 antibody (70R-4675)

RAE1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAE1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAE1 is a homolog of yeast Rae1. It contains four WD40 motifs, and has been shown to localize to distinct foci in the nucleoplasm, to the nuclear rim, and to meshwork-like structures throughout the cytoplasm. This gene is thought to be involved in nucleocytoplasmic transport, and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using RAE1 antibody (70R-4675) | RAE1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X.
  • Western Blot analysis using RAE1 antibody (70R-4675) | RAE1 antibody (70R-4675) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors