RALYL antibody (70R-4982)

Rabbit polyclonal RALYL antibody raised against the C terminal of RALYL

Synonyms Polyclonal RALYL antibody, Anti-RALYL antibody, Raly Rna Binding Protein-Like antibody, HNRPCL3 antibody, RNA Binding Protein Autoantigenic antibody
Specificity RALYL antibody was raised against the C terminal of RALYL
Cross Reactivity Human
Applications WB
Immunogen RALYL antibody was raised using the C terminal of RALYL corresponding to a region with amino acids AQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFD
Assay Information RALYL Blocking Peptide, catalog no. 33R-1450, is also available for use as a blocking control in assays to test for specificity of this RALYL antibody


Western Blot analysis using RALYL antibody (70R-4982)

RALYL antibody (70R-4982) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RALYL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RALYL belongs to the RRM HNRPC family, RALY subfamily. It contains 1 RRM (RNA recognition motif) domain. The functions of RALYL remain unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RALYL antibody (70R-4982) | RALYL antibody (70R-4982) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors