Ran antibody (70R-5529)

Rabbit polyclonal Ran antibody raised against the middle region of RAN

Synonyms Polyclonal Ran antibody, Anti-Ran antibody, TC4 antibody, Ran Member Ras Oncogene Family antibody, Gsp1 antibody, ARA24 antibody
Specificity Ran antibody was raised against the middle region of RAN
Cross Reactivity Human,Mouse,Rat,Dog,C.elegans,Drosophila
Applications WB
Immunogen Ran antibody was raised using the middle region of RAN corresponding to a region with amino acids NLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA
Assay Information Ran Blocking Peptide, catalog no. 33R-6771, is also available for use as a blocking control in assays to test for specificity of this Ran antibody


Western Blot analysis using Ran antibody (70R-5529)

Ran antibody (70R-5529) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RAN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RAN (ras-related nuclear protein) is a small GTP binding protein belonging to the RAS superfamily that is essential for the translocation of RNA and proteins through the nuclear pore complex.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Ran antibody (70R-5529) | Ran antibody (70R-5529) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £272.51
Size: 50 ug
View Our Distributors