RARA antibody (70R-4609)

Rabbit polyclonal RARA antibody raised against the N terminal of RARA

Synonyms Polyclonal RARA antibody, Anti-RARA antibody, Retinoic Acid Receptor Alpha antibody, RAR antibody, NR1B1 antibody
Specificity RARA antibody was raised against the N terminal of RARA
Cross Reactivity Human
Applications WB
Immunogen RARA antibody was raised using the N terminal of RARA corresponding to a region with amino acids YESVEVGGPTPNPFLVVDFYNQNRACLLPEKGLPAPGPYSTPLRTPLWNG
Assay Information RARA Blocking Peptide, catalog no. 33R-10090, is also available for use as a blocking control in assays to test for specificity of this RARA antibody

Images

Western Blot analysis using RARA antibody (70R-4609)

RARA antibody (70R-4609) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RARA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Retinoid signaling is transduced by 2 families of nuclear receptors, retinoic acid receptor (RAR) and retinoid X receptor, which form RXR/RAR heterodimers. In the absence of ligand, DNA-bound RXR/RARA represses transcription by recruiting the corepressors NCOR1, SMRT, and histone deacetylase. When ligand binds to the complex, it induces a conformational change allowing the recruitment of coactivators, histone acetyltransferases, and the basic transcription machinery.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RARA antibody (70R-4609) | RARA antibody (70R-4609) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors