RARRES3 antibody (70R-1725)

Rabbit polyclonal RARRES3 antibody

Synonyms Polyclonal RARRES3 antibody, Anti-RARRES3 antibody, TIG3 antibody, HRASLS4 antibody, Tazarotene Induced 3 antibody, RARRES-3 antibody, RARRES 3, MGC8906 antibody, RARRES3, RARRES 3 antibody, Retinoic Acid Receptor Responder antibody, RARRES-3, RIG1 antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen RARRES3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMV
Assay Information RARRES3 Blocking Peptide, catalog no. 33R-3082, is also available for use as a blocking control in assays to test for specificity of this RARRES3 antibody

Images

Western Blot analysis using RARRES3 antibody (70R-1725)

RARRES3 antibody (70R-1725) used at 5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 18 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RARRES3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Retinoids exert biologic effects such as potent growth inhibitory and cell differentiation activities and are used in the treatment of hyperproliferative dermatological diseases. These effects are mediated by specific nuclear receptor proteins that are members of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. RARRES3 is thought act as a tumor suppressor or growth regulator.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RARRES3 antibody (70R-1725) | RARRES3 antibody (70R-1725) used at 5 ug/ml to detect target protein.
  • Immunohistochemical staining using RARRES3 antibody (70R-1725) | RARRES3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Surface mucous cells and Epithelial cells of fundic gland (arrows) in Human Stomach. Magnification is at 400X

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors